Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCRT2 Rabbit Polyclonal Antibody (FITC)

SCRT2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF898B

UniProt

Q9NQ03

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SCRT2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACAKAAEPPPPTPAGPAS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_149120

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hey2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7021308 1.0 µg DNA

Hey2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
H2AX (Ubiquityl Lys119) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-8571R-BF680-TR 20 µL

H2AX (Ubiquityl Lys119) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
TOMM34 (Translocase of Outer Membrane 34kD Subunit, Mitochondrial Import Receptor Subunit TOM34, hTom34, HTOM34P, URCC3) (AP)
MBS6396907-01 0.1 mL

TOMM34 (Translocase of Outer Membrane 34kD Subunit, Mitochondrial Import Receptor Subunit TOM34, hTom34, HTOM34P, URCC3) (AP)

Sign In for Pricing
View Details
TOMM34 (Translocase of Outer Membrane 34kD Subunit, Mitochondrial Import Receptor Subunit TOM34, hTom34, HTOM34P, URCC3) (AP)
MBS6396907-02 5x 0.1 mL

TOMM34 (Translocase of Outer Membrane 34kD Subunit, Mitochondrial Import Receptor Subunit TOM34, hTom34, HTOM34P, URCC3) (AP)

Sign In for Pricing
View Details
Recombinant Human C-X-C chemokine receptor type 4 (CXCR4)
MBS7112672-01 0.01 mg

Recombinant Human C-X-C chemokine receptor type 4 (CXCR4)

Sign In for Pricing
View Details
Recombinant Human C-X-C chemokine receptor type 4 (CXCR4)
MBS7112672-02 0.05 mg

Recombinant Human C-X-C chemokine receptor type 4 (CXCR4)

Sign In for Pricing
View Details