Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNTTIP1 Rabbit Polyclonal Antibody (FITC)

DNTTIP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Tdif1, C20orf167, dJ447F3.4

UniProt

Q5QPF3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DNTTIP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CLEQAKLLFSDGEKVIPRLTHELPGIKRGRQAEEECAHRGSPLPKKRKGR

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

CAI21035

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyk 2 CRISPR Activation Plasmid (h2)
sc-400902-ACT-2 20 µg

Tyk 2 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. holarctica Ribonuclease PH (rph)
MBS1348826-01 0.02 mg (E-Coli)

Recombinant Francisella tularensis subsp. holarctica Ribonuclease PH (rph)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. holarctica Ribonuclease PH (rph)
MBS1348826-02 0.1 mg (E-Coli)

Recombinant Francisella tularensis subsp. holarctica Ribonuclease PH (rph)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. holarctica Ribonuclease PH (rph)
MBS1348826-03 0.02 mg (Yeast)

Recombinant Francisella tularensis subsp. holarctica Ribonuclease PH (rph)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. holarctica Ribonuclease PH (rph)
MBS1348826-04 0.1 mg (Yeast)

Recombinant Francisella tularensis subsp. holarctica Ribonuclease PH (rph)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. holarctica Ribonuclease PH (rph)
MBS1348826-05 0.02 mg (Baculovirus)

Recombinant Francisella tularensis subsp. holarctica Ribonuclease PH (rph)

Sign In for Pricing
View Details