Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp583 Rabbit Polyclonal Antibody (HRP)

Zfp583 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Znf583, BC056221

UniProt

Q3V080

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAFSQIAHLTQHQRIHTGE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001028421

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Serum Albumin/HSA Protein (C-8His)
MBS2553227-01 0.01 mg

Recombinant Human Serum Albumin/HSA Protein (C-8His)

Sign In for Pricing
View Details
Recombinant Human Serum Albumin/HSA Protein (C-8His)
MBS2553227-02 0.05 mg

Recombinant Human Serum Albumin/HSA Protein (C-8His)

Sign In for Pricing
View Details
Recombinant Human Serum Albumin/HSA Protein (C-8His)
MBS2553227-03 5x 0.05 mg

Recombinant Human Serum Albumin/HSA Protein (C-8His)

Sign In for Pricing
View Details
Rabbit Polyclonal NFIC Antibody [DyLight 594]
NBP1-71879DL594 0.1 mL

Rabbit Polyclonal NFIC Antibody [DyLight 594]

Sign In for Pricing
View Details
Adrenodoxin Rabbit Polyclonal Antibody (BF750)
orb2544435 100 µL

Adrenodoxin Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Chicken Collagen Type III (COL3) ELISA KIT
EIA05503Ch 1 Kit

Chicken Collagen Type III (COL3) ELISA KIT

Sign In for Pricing
View Details