Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP90 Rabbit Polyclonal Antibody (FITC)

ZFP90 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FIK, NK10, ZNF756, zfp-90

UniProt

Q8TF47

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZFP90

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SSLVQHQRIHTGEKPYRCNLCGRSFRHGTSLTQHEVTHSGEKPFQCKECG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_597715

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASAH1 sgRNA CRISPR Lentivector (Human) (Target 1)
K0130402 1.0 µg DNA

ASAH1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal FIGNL1 Antibody [PerCP]
NB100-2356PCP 0.1 mL

Rabbit Polyclonal FIGNL1 Antibody [PerCP]

Sign In for Pricing
View Details
ZNF22 Antibody
E306449 100 µg - 200 µL

ZNF22 Antibody

Sign In for Pricing
View Details
Adrenergic Receptor Beta Kinase 2 (ADRbK2), Recombinant, Human, His-Tag
049080-01 10 µg

Adrenergic Receptor Beta Kinase 2 (ADRbK2), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Adrenergic Receptor Beta Kinase 2 (ADRbK2), Recombinant, Human, His-Tag
049080-02 50 µg

Adrenergic Receptor Beta Kinase 2 (ADRbK2), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Adrenergic Receptor Beta Kinase 2 (ADRbK2), Recombinant, Human, His-Tag
049080-03 100 µg

Adrenergic Receptor Beta Kinase 2 (ADRbK2), Recombinant, Human, His-Tag

Sign In for Pricing
View Details