Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF840P Rabbit Polyclonal Antibody (FITC)

ZNF840P Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C20orf157, ZNF840

UniProt

A6NDX5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF678

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FSNLTQHKRIHTGEKPYKCKECCKAFNKFSNLTQHKRIHTGEKPYKCEEC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C14orf106 (MIS18BP1) activation kit by CRISPRa
GA110700 1 Kit

Human C14orf106 (MIS18BP1) activation kit by CRISPRa

Sign In for Pricing
View Details
Human ATP13A5 activation kit by CRISPRa
GA117602 1 Kit

Human ATP13A5 activation kit by CRISPRa

Sign In for Pricing
View Details
Calcium Ascorbate Dihydrate
TRC-C145025-5G 5 g

Calcium Ascorbate Dihydrate

Sign In for Pricing
View Details
Human HOX11 (TLX1) activation kit by CRISPRa
GA102181 1 Kit

Human HOX11 (TLX1) activation kit by CRISPRa

Sign In for Pricing
View Details
RAB11FIP1 Human qPCR Primer Pair (NM_025151)
HP229584 200 Reactions

RAB11FIP1 Human qPCR Primer Pair (NM_025151)

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-100 1x 100 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details