Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF840P Rabbit Polyclonal Antibody (HRP)

ZNF840P Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C20orf157, ZNF840

UniProt

A6NDX5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF678

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSNLTQHKRIHTGEKPYKCKECCKAFNKFSNLTQHKRIHTGEKPYKCEEC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant RLN2 Antibody
RC-5260-01 50 μL

Recombinant RLN2 Antibody

Sign In for Pricing
View Details
Recombinant RLN2 Antibody
RC-5260-02 100 µL

Recombinant RLN2 Antibody

Sign In for Pricing
View Details
Recombinant RLN2 Antibody
RC-5260-03 1 mL

Recombinant RLN2 Antibody

Sign In for Pricing
View Details
PS2 (TFF1/1091), CF640R conjugate, 0.1mg/mL
BNC401091-500 1x 500 µL

PS2 (TFF1/1091), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/1120), CF647 conjugate, 0.1mg/mL
BNC471120-100 1x 100 µL

Ep-CAM / CD326 (EGP40/1120), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TIPRL activation kit by CRISPRa
GA116935 1 Kit

Human TIPRL activation kit by CRISPRa

Sign In for Pricing
View Details