Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19orf2 Rabbit Polyclonal Antibody (FITC)

C19orf2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RMP, URI, NNX3, C19orf2, PPP1R19

UniProt

Q6NX55

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C19orf2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_604431

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human VAMP2 (Vesicle associated membrane protein 2) Expressed in vitro E.coli expression system, Full Length of Mature Protein
MPX3680K Each

Magic™ Membrane Protein Human VAMP2 (Vesicle associated membrane protein 2) Expressed in vitro E.coli expression system, Full Length of Mature Protein

Sign In for Pricing
View Details
Canine IgG3, lambda Isotype Control Antibody (HyHEL-10), APC
MBS1586212-01 50 Tests

Canine IgG3, lambda Isotype Control Antibody (HyHEL-10), APC

Sign In for Pricing
View Details
Canine IgG3, lambda Isotype Control Antibody (HyHEL-10), APC
MBS1586212-02 100 Tests

Canine IgG3, lambda Isotype Control Antibody (HyHEL-10), APC

Sign In for Pricing
View Details
Canine IgG3, lambda Isotype Control Antibody (HyHEL-10), APC
MBS1586212-03 5x 100 Tests

Canine IgG3, lambda Isotype Control Antibody (HyHEL-10), APC

Sign In for Pricing
View Details
Cdc14ab Antibody
orb859121 2 mg

Cdc14ab Antibody

Sign In for Pricing
View Details
FAM164B sgRNA CRISPR Lentivector (Human) (Target 3)
K0751504 1.0 µg DNA

FAM164B sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details