Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF563 Rabbit Polyclonal Antibody (FITC)

ZNF563 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ34797

UniProt

Q8TA94

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF563

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ETIRNLDCIRMIWEEQNTEDQYKNPRRNLRCHMVERFSESKDSSQCGETF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_660319

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR5707 Recombinant Protein (Human)
RP074736 100 µg

MIR5707 Recombinant Protein (Human)

Sign In for Pricing
View Details
Human signal transducer and activator of transcription 4, STAT4 ELISA Kit
MBS161115-01 48 Well

Human signal transducer and activator of transcription 4, STAT4 ELISA Kit

Sign In for Pricing
View Details
Human signal transducer and activator of transcription 4, STAT4 ELISA Kit
MBS161115-02 96 Well

Human signal transducer and activator of transcription 4, STAT4 ELISA Kit

Sign In for Pricing
View Details
Human signal transducer and activator of transcription 4, STAT4 ELISA Kit
MBS161115-03 5x 96 Well

Human signal transducer and activator of transcription 4, STAT4 ELISA Kit

Sign In for Pricing
View Details
Human signal transducer and activator of transcription 4, STAT4 ELISA Kit
MBS161115-04 10x 96 Well

Human signal transducer and activator of transcription 4, STAT4 ELISA Kit

Sign In for Pricing
View Details
Rat Pudp Pre-designed siRNA Set B
SI211396B 1 Each

Rat Pudp Pre-designed siRNA Set B

Sign In for Pricing
View Details