Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tceal7 Rabbit Polyclonal Antibody (HRP)

Tceal7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

1110018P05Rik

UniProt

A3KGA4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLLQSLEEFKEDIDYRHFKGEEMTGEEEEMERCLEEIRSLRKKFRALHSN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001120641

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIC2 (Chloride Intracellular Channel Protein 2, XAP121, CLIC2) (PE)
MBS6455193-01 0.1 mL

CLIC2 (Chloride Intracellular Channel Protein 2, XAP121, CLIC2) (PE)

Sign In for Pricing
View Details
CLIC2 (Chloride Intracellular Channel Protein 2, XAP121, CLIC2) (PE)
MBS6455193-02 5x 0.1 mL

CLIC2 (Chloride Intracellular Channel Protein 2, XAP121, CLIC2) (PE)

Sign In for Pricing
View Details
RIPK3 Antibody
E19-7339 100 µg -100 µL

RIPK3 Antibody

Sign In for Pricing
View Details
Transforming Growth Factor Beta-activated Kinase-binding Protein 1 (TAB1) (MAP3K7IP1) Rabbit anti-Human Polyclonal Antibody
GWB-652DB2 0.05 mg

Transforming Growth Factor Beta-activated Kinase-binding Protein 1 (TAB1) (MAP3K7IP1) Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
Human Endothelial Cell Adhesion Molecule (ESAM) ELISA Kit
RDR-ESAM-Hu-01 96 Tests

Human Endothelial Cell Adhesion Molecule (ESAM) ELISA Kit

Sign In for Pricing
View Details
Human Endothelial Cell Adhesion Molecule (ESAM) ELISA Kit
RDR-ESAM-Hu-02 48 Tests

Human Endothelial Cell Adhesion Molecule (ESAM) ELISA Kit

Sign In for Pricing
View Details