Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF565 Rabbit Polyclonal Antibody (Biotin)

ZNF565 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ36991

UniProt

Q8N9K5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF565

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VSQLTHHQRIHTCEKPYECRECGMAFIRSSQLTEHQRIHPGIKPYECREC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689690

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm3402 3'UTR Luciferase Stable Cell Line
TU107945 1.0 mL

Gm3402 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MRPL33 Human shRNA Plasmid Kit (Locus ID 9553)
TR319102 1 Kit

MRPL33 Human shRNA Plasmid Kit (Locus ID 9553)

Sign In for Pricing
View Details
Recombinant Danio rerio Mitochondrial intermembrane space import and assembly protein 40 (chchd4)
MBS1349357-01 0.02 mg (E-Coli)

Recombinant Danio rerio Mitochondrial intermembrane space import and assembly protein 40 (chchd4)

Sign In for Pricing
View Details
Recombinant Danio rerio Mitochondrial intermembrane space import and assembly protein 40 (chchd4)
MBS1349357-02 0.1 mg (E-Coli)

Recombinant Danio rerio Mitochondrial intermembrane space import and assembly protein 40 (chchd4)

Sign In for Pricing
View Details
Recombinant Danio rerio Mitochondrial intermembrane space import and assembly protein 40 (chchd4)
MBS1349357-03 0.02 mg (Yeast)

Recombinant Danio rerio Mitochondrial intermembrane space import and assembly protein 40 (chchd4)

Sign In for Pricing
View Details
Recombinant Danio rerio Mitochondrial intermembrane space import and assembly protein 40 (chchd4)
MBS1349357-04 0.1 mg (Yeast)

Recombinant Danio rerio Mitochondrial intermembrane space import and assembly protein 40 (chchd4)

Sign In for Pricing
View Details