Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF362 Rabbit Polyclonal Antibody (HRP)

ZNF362 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RN, lin-29

UniProt

Q5T0B9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF362

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSQLDNLVLINKIKEQLMAEKIRPPHLPPTSASSQQPLLVPPAPAESSQA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689706

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hus1 (NM_001109092) Rat Tagged ORF Clone Lentiviral Particle
RR204193L3V 200 µL

Hus1 (NM_001109092) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Duck Eukaryotic Translation Initiation Factor 3 Subunit B (EIF3B) ELISA Kit
MBS9929014 Inquire

Duck Eukaryotic Translation Initiation Factor 3 Subunit B (EIF3B) ELISA Kit

Sign In for Pricing
View Details
IGBP1 (NM_001551) Human Tagged ORF Clone Lentiviral Particle
RC200387L1V 200 µL

IGBP1 (NM_001551) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Ikaros (IKZF1) Rabbit Monoclonal Antibody
TA423594 100 µL

Ikaros (IKZF1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Monkey Ferredoxin 1 (FDX1) ELISA Kit
MBS9900061-01 48 Well

Monkey Ferredoxin 1 (FDX1) ELISA Kit

Sign In for Pricing
View Details
Monkey Ferredoxin 1 (FDX1) ELISA Kit
MBS9900061-02 96 Well

Monkey Ferredoxin 1 (FDX1) ELISA Kit

Sign In for Pricing
View Details