Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF362 Rabbit Polyclonal Antibody (FITC)

ZNF362 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RN, lin-29

UniProt

Q5T0B9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF362

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KHAKAYCCSMCGRAYTSETYLMKHMSKHTVVEHLVSHHSPQRTESPGIPV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689706

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX7 Human Over-expression Lysate
orb1339536 100 µg

SNX7 Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Ip6k1 Pre-designed siRNA Set B
SI206813B 1 Each

Rat Ip6k1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
NIFUN (Iron-Sulfur Cluster Assembly Enzyme ISCU, Mitochondrial, NifU-like N-Terminal Domain-Containing Protein, NifU-like Protein, ISCU) (Biotin)
130373-Biotin 100 µL

NIFUN (Iron-Sulfur Cluster Assembly Enzyme ISCU, Mitochondrial, NifU-like N-Terminal Domain-Containing Protein, NifU-like Protein, ISCU) (Biotin)

Sign In for Pricing
View Details
ACPT Rabbit Polyclonal Antibody (Cy5)
orb888065 100 µL

ACPT Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Recombinant Staphylococcus haemolyticus Phosphatidate cytidylyltransferase (cdsA)
MBS7011253-01 0.02 mg

Recombinant Staphylococcus haemolyticus Phosphatidate cytidylyltransferase (cdsA)

Sign In for Pricing
View Details
Recombinant Staphylococcus haemolyticus Phosphatidate cytidylyltransferase (cdsA)
MBS7011253-02 0.1 mg

Recombinant Staphylococcus haemolyticus Phosphatidate cytidylyltransferase (cdsA)

Sign In for Pricing
View Details