Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF362 Rabbit Polyclonal Antibody (FITC)

ZNF362 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RN, lin-29

UniProt

Q5T0B9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF362

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KHAKAYCCSMCGRAYTSETYLMKHMSKHTVVEHLVSHHSPQRTESPGIPV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689706

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant DENV (type 2, strain New Guinea C/PUO-218 hybrid) E / Envelope Protein (ECD, His Tag)
PKSV030127 100 µg

Recombinant DENV (type 2, strain New Guinea C/PUO-218 hybrid) E / Envelope Protein (ECD, His Tag)

Sign In for Pricing
View Details
Plate Sealer BPPS-101
BPPS-101 1 Unit

Plate Sealer BPPS-101

Sign In for Pricing
View Details
Recombinant Human SPEG/APEG-1 Protein (His Tag)
PKSH030334 50 µg

Recombinant Human SPEG/APEG-1 Protein (His Tag)

Sign In for Pricing
View Details
Chymotrypsin Activity Colorimetric Assay Kit
E-BC-K845-M-01 48 T (32 samples)

Chymotrypsin Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
Chymotrypsin Activity Colorimetric Assay Kit
E-BC-K845-M-02 96 T (80 samples)

Chymotrypsin Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
PE Anti-Human CD3 Antibody[OKT-3]
E-AB-F1001D-01 20 Tests

PE Anti-Human CD3 Antibody[OKT-3]

Sign In for Pricing
View Details