Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRFBP1 Rabbit Polyclonal Antibody (HRP)

SRFBP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P49, Rlb1, BUD22, STRAP, p49/STRAP

UniProt

Q8NEF9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SRFBP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKSKKGTEDALLKNQRRAQRLLEEIHAMKELKPDIVTKSALGDDINFEKI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689759

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-BLOC1S3 Antibody
CTA4844-01 30 µL

Anti-BLOC1S3 Antibody

Sign In for Pricing
View Details
Anti-BLOC1S3 Antibody
CTA4844-02 50 μL

Anti-BLOC1S3 Antibody

Sign In for Pricing
View Details
Anti-BLOC1S3 Antibody
CTA4844-03 100 µL

Anti-BLOC1S3 Antibody

Sign In for Pricing
View Details
Anti-BLOC1S3 Antibody
CTA4844-04 200 µL

Anti-BLOC1S3 Antibody

Sign In for Pricing
View Details
Guinea pig Interleukin 10 (IL10)(Sandwich ELISA) Mini sample ELISA Kit
MBS2140281-01 24 Strip Well

Guinea pig Interleukin 10 (IL10)(Sandwich ELISA) Mini sample ELISA Kit

Sign In for Pricing
View Details
Guinea pig Interleukin 10 (IL10)(Sandwich ELISA) Mini sample ELISA Kit
MBS2140281-02 48 Well

Guinea pig Interleukin 10 (IL10)(Sandwich ELISA) Mini sample ELISA Kit

Sign In for Pricing
View Details