Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRFBP1 Rabbit Polyclonal Antibody (FITC)

SRFBP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P49, Rlb1, BUD22, STRAP, p49/STRAP

UniProt

Q8NEF9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SRFBP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EEFCEEEKEYFDDSTEERFYKQSSMSEDSDSGDDFFIGKVRRTRKKESSC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

EAW48899

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LGI2 Protein - (Dry Ice)
H00055203-Q01-10ug 10 µg

Recombinant Human LGI2 Protein - (Dry Ice)

Sign In for Pricing
View Details
Chicken Ubiquitin Carboxyl Terminal Hydrolase L1 ELISA Kit
MBS095653 Inquire

Chicken Ubiquitin Carboxyl Terminal Hydrolase L1 ELISA Kit

Sign In for Pricing
View Details
Mini Pleated Cartridge, PTFE phobic,0.2μm, Low Bio,1000cm2, OD:56mm,118w/long luggs, Polypro, Silicone, SS reinforced, Rev.0
CMKPT0020BSS0FY8PSY0 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Mini Pleated Cartridge, PTFE phobic,0.2μm, Low Bio,1000cm2, OD:56mm,118w/long luggs, Polypro, Silicone, SS reinforced, Rev.0

Sign In for Pricing
View Details
CA12 Rabbit pAb
A10187 50 µL

CA12 Rabbit pAb

Sign In for Pricing
View Details
VLDL Receptor (VLDLR) (NM_003383) Human Over-expression Lysate
LS007436 100 µg

VLDL Receptor (VLDLR) (NM_003383) Human Over-expression Lysate

Sign In for Pricing
View Details
Bovine Myeloid Antimicrobial Peptide 29 ELISA kit
GTR10459938 96 Well

Bovine Myeloid Antimicrobial Peptide 29 ELISA kit

Sign In for Pricing
View Details