Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRFBP1 Rabbit Polyclonal Antibody (FITC)

SRFBP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P49, Rlb1, BUD22, STRAP, p49/STRAP

UniProt

Q8NEF9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SRFBP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EEFCEEEKEYFDDSTEERFYKQSSMSEDSDSGDDFFIGKVRRTRKKESSC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

EAW48899

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-3971 miRNA Mimic
orb1875126-01 5 nmol

Mmu-miR-3971 miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-3971 miRNA Mimic
orb1875126-02 10 nmol

Mmu-miR-3971 miRNA Mimic

Sign In for Pricing
View Details
APRG1 (C3orf35) (NM_178342) Human Tagged ORF Clone
RC214502 10 µg

APRG1 (C3orf35) (NM_178342) Human Tagged ORF Clone

Sign In for Pricing
View Details
TRIB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B11]
TA805275AM 100 µL

TRIB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B11]

Sign In for Pricing
View Details
Recombinant Rat Potassium voltage-gated channel subfamily E member 2 (Kcne2)
CSB-EP012027RA-01 20 µg

Recombinant Rat Potassium voltage-gated channel subfamily E member 2 (Kcne2)

Sign In for Pricing
View Details
Recombinant Rat Potassium voltage-gated channel subfamily E member 2 (Kcne2)
CSB-EP012027RA-02 100 µg

Recombinant Rat Potassium voltage-gated channel subfamily E member 2 (Kcne2)

Sign In for Pricing
View Details