Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRFBP1 Rabbit Polyclonal Antibody (HRP)

SRFBP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P49, Rlb1, BUD22, STRAP, p49/STRAP

UniProt

Q8NEF9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SRFBP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEFCEEEKEYFDDSTEERFYKQSSMSEDSDSGDDFFIGKVRRTRKKESSC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

EAW48899

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphoserine-2-OH Antibody
E55A14906 100 µg

Phosphoserine-2-OH Antibody

Sign In for Pricing
View Details
Olfr1469 Mouse shRNA Plasmid (Locus ID 258690)
TL507846 1 Kit

Olfr1469 Mouse shRNA Plasmid (Locus ID 258690)

Sign In for Pricing
View Details
CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (HRP)
C2404-46G2-HRP 100 µL

CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (HRP)

Sign In for Pricing
View Details
Immortalized Drosophila Embryonic Cells (R4)
T0703 1x 10^6 Cells - 1.0 mL

Immortalized Drosophila Embryonic Cells (R4)

Sign In for Pricing
View Details
C1D (NM_006333) Human Tagged Lenti ORF Clone
RC202688L3 10 µg

C1D (NM_006333) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
H-2Kk Antibody [16-3-22S] (FITC)
99-102 0.5 mg

H-2Kk Antibody [16-3-22S] (FITC)

Sign In for Pricing
View Details