Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vgll2 Rabbit Polyclonal Antibody (Biotin)

Vgll2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Vi, VIT, Vgl, Vito1, vgl-2, VITO-1, C130057C21Rik

UniProt

Q8BGW8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SGSSSFSNPTPASVKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_722481

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SpeD Antibody
orb832783 2 mg

SpeD Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Transcobalamin II Antibody [mFluor Violet 610 SE]
NBP2-98341MFV610 0.1 mL

Rabbit Polyclonal Transcobalamin II Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (MaxLight 550)
MBS6212348-01 0.1 mL

LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (MaxLight 550)

Sign In for Pricing
View Details
LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (MaxLight 550)
MBS6212348-02 5x 0.1 mL

LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (MaxLight 550)

Sign In for Pricing
View Details
KDM1A Protein Vector (Mouse) (pPM-C-HA)
PV194012 500 ng

KDM1A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse High mobility group protein B2 (HMGB2) ELISA kit
GTR10389757 96 Well

Mouse High mobility group protein B2 (HMGB2) ELISA kit

Sign In for Pricing
View Details