Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vgll2 Rabbit Polyclonal Antibody (HRP)

Vgll2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Vi, VIT, Vgl, Vito1, vgl-2, VITO-1, C130057C21Rik

UniProt

Q8BGW8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGSSSFSNPTPASVKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_722481

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Caprin 2 (CAPRIN2) ELISA kit
GTR10465425 96 Well

Porcine Caprin 2 (CAPRIN2) ELISA kit

Sign In for Pricing
View Details
Sheep Phosphoinositide-3-Kinase Catalytic Beta Polypeptide ELISA Kit
MBS049396-01 48 Well

Sheep Phosphoinositide-3-Kinase Catalytic Beta Polypeptide ELISA Kit

Sign In for Pricing
View Details
Sheep Phosphoinositide-3-Kinase Catalytic Beta Polypeptide ELISA Kit
MBS049396-02 96 Well

Sheep Phosphoinositide-3-Kinase Catalytic Beta Polypeptide ELISA Kit

Sign In for Pricing
View Details
Sheep Phosphoinositide-3-Kinase Catalytic Beta Polypeptide ELISA Kit
MBS049396-03 5x 96 Well

Sheep Phosphoinositide-3-Kinase Catalytic Beta Polypeptide ELISA Kit

Sign In for Pricing
View Details
Sheep Phosphoinositide-3-Kinase Catalytic Beta Polypeptide ELISA Kit
MBS049396-04 10x 96 Well

Sheep Phosphoinositide-3-Kinase Catalytic Beta Polypeptide ELISA Kit

Sign In for Pricing
View Details
CAP1 Rabbit monoclonal antibody
E43S41400 100 µL

CAP1 Rabbit monoclonal antibody

Sign In for Pricing
View Details