Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2A1L Rabbit Polyclonal Antibody (HRP)

GTF2A1L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ALF

UniProt

Q9UNN4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2A1L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RVTDDDIGEIIQVDGSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_006863

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha Sarcoglycan Rabbit mAb
E2R23449 100 µL

Alpha Sarcoglycan Rabbit mAb

Sign In for Pricing
View Details
Human p53 Upregulated Modulator Of Apoptosis (PUMA) ELISA Kit
MBS2023936-01 24 Strip Well

Human p53 Upregulated Modulator Of Apoptosis (PUMA) ELISA Kit

Sign In for Pricing
View Details
Human p53 Upregulated Modulator Of Apoptosis (PUMA) ELISA Kit
MBS2023936-02 48 Well

Human p53 Upregulated Modulator Of Apoptosis (PUMA) ELISA Kit

Sign In for Pricing
View Details
Human p53 Upregulated Modulator Of Apoptosis (PUMA) ELISA Kit
MBS2023936-03 96 Well

Human p53 Upregulated Modulator Of Apoptosis (PUMA) ELISA Kit

Sign In for Pricing
View Details
Human p53 Upregulated Modulator Of Apoptosis (PUMA) ELISA Kit
MBS2023936-04 5x 96 Well

Human p53 Upregulated Modulator Of Apoptosis (PUMA) ELISA Kit

Sign In for Pricing
View Details
Human p53 Upregulated Modulator Of Apoptosis (PUMA) ELISA Kit
MBS2023936-05 10x 96 Well

Human p53 Upregulated Modulator Of Apoptosis (PUMA) ELISA Kit

Sign In for Pricing
View Details