Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIN9 Rabbit Polyclonal Antibody (HRP)

LIN9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TGS, BARA, TGS1, TGS2, Lin-9, BARPsv

UniProt

Q5TKA1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LIN9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLQKTPVWKGRNTSSAVEMPFRNSKRSRLFSDEDDRQINTRSPKRNQRVA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775106

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIITA Polyclonal Antibody
MBS9234926-01 0.1 mL

CIITA Polyclonal Antibody

Sign In for Pricing
View Details
CIITA Polyclonal Antibody
MBS9234926-02 5x 0.1 mL

CIITA Polyclonal Antibody

Sign In for Pricing
View Details
NeuN Antibody / Fox3
RQ4501 100 µL

NeuN Antibody / Fox3

Sign In for Pricing
View Details
Fibrillin 1 (BSA & Azide Free) discontinued
F4195X 100 µg

Fibrillin 1 (BSA & Azide Free) discontinued

Sign In for Pricing
View Details
Nori® Porcine 2-Plex ELISA Kits-CT-1/cTnT
GR224187 96 Well

Nori® Porcine 2-Plex ELISA Kits-CT-1/cTnT

Sign In for Pricing
View Details
Camel Von Willebrand Factor A Domain Containing Protein 5A (VWA5A) ELISA Kit
MBS9927859-01 48 Well

Camel Von Willebrand Factor A Domain Containing Protein 5A (VWA5A) ELISA Kit

Sign In for Pricing
View Details