Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIN9 Rabbit Polyclonal Antibody (HRP)

LIN9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TGS, BARA, TGS1, TGS2, Lin-9, BARPsv

UniProt

B1B046

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LIN9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

CAI14231

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSX2IP (Synovial Sarcoma X Breakpoint 2 Interacting Protein, SSX2-interacting Protein, Afadin and alpha Actinin Binding Protein, Afadin DIL Domain Interacting Protein, Afadin-and alpha-actinin-binding Protein, ADIP, FLJ10848, KIAA0923, MGC75026) (AP)
MBS6395158-01 0.1 mL

SSX2IP (Synovial Sarcoma X Breakpoint 2 Interacting Protein, SSX2-interacting Protein, Afadin and alpha Actinin Binding Protein, Afadin DIL Domain Interacting Protein, Afadin-and alpha-actinin-binding Protein, ADIP, FLJ10848, KIAA0923, MGC75026) (AP)

Sign In for Pricing
View Details
SSX2IP (Synovial Sarcoma X Breakpoint 2 Interacting Protein, SSX2-interacting Protein, Afadin and alpha Actinin Binding Protein, Afadin DIL Domain Interacting Protein, Afadin-and alpha-actinin-binding Protein, ADIP, FLJ10848, KIAA0923, MGC75026) (AP)
MBS6395158-02 5x 0.1 mL

SSX2IP (Synovial Sarcoma X Breakpoint 2 Interacting Protein, SSX2-interacting Protein, Afadin and alpha Actinin Binding Protein, Afadin DIL Domain Interacting Protein, Afadin-and alpha-actinin-binding Protein, ADIP, FLJ10848, KIAA0923, MGC75026) (AP)

Sign In for Pricing
View Details
Recombinant Pig Cadherin-3 (CDH3)
MBS7110986-01 0.02 mg (E-Coli)

Recombinant Pig Cadherin-3 (CDH3)

Sign In for Pricing
View Details
Recombinant Pig Cadherin-3 (CDH3)
MBS7110986-02 0.1 mg (E-Coli)

Recombinant Pig Cadherin-3 (CDH3)

Sign In for Pricing
View Details
Recombinant Pig Cadherin-3 (CDH3)
MBS7110986-03 1 mg (E-Coli)

Recombinant Pig Cadherin-3 (CDH3)

Sign In for Pricing
View Details
Recombinant Pig Cadherin-3 (CDH3)
MBS7110986-04 5x 1 mg (E-Coli)

Recombinant Pig Cadherin-3 (CDH3)

Sign In for Pricing
View Details