Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP41 Rabbit Polyclonal Antibody (FITC)

ZFP41 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF753, zfp-41

UniProt

Q8N8Y5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZFP41

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PRTEPCLSPEDEEHVFDAFDASFKDDFEGVPVFIPFQRKKPYECSECGRI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUCY2D Rabbit Polyclonal Antibody
TA376880 100 µL

GUCY2D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), 0.2mg/mL
BNUB1474-100 1x 100 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), 0.2mg/mL

Sign In for Pricing
View Details
GPBP1 (NM_001127236) Human Over-expression Lysate
LC426733 20 µg

GPBP1 (NM_001127236) Human Over-expression Lysate

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF405S conjugate, 0.1mg/mL
BNC042026-100 1x 100 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RICH2 (ARHGAP44) (C-term) Rabbit Polyclonal Antibody
AP53665PU-N 400 µL

RICH2 (ARHGAP44) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rat CCL5/RANTES Protein (His Tag)
PKSR030422-01 10 µg

Recombinant Rat CCL5/RANTES Protein (His Tag)

Sign In for Pricing
View Details