Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF680 Rabbit Polyclonal Antibody (FITC)

ZNF680 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ90430

UniProt

Q8NEM1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF680

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RGYGKCGHENLQLRISCKSVDESKVFKEGYNELNQCLRTTQSKIFQCDKY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_848653

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD57 / B3GAT1 (Natural Killer Cell Marker) Antibody - With BSA and Azide
orb1462558-01 20 µg

CD57 / B3GAT1 (Natural Killer Cell Marker) Antibody - With BSA and Azide

Sign In for Pricing
View Details
CD57 / B3GAT1 (Natural Killer Cell Marker) Antibody - With BSA and Azide
orb1462558-02 100 µg

CD57 / B3GAT1 (Natural Killer Cell Marker) Antibody - With BSA and Azide

Sign In for Pricing
View Details
Syntaxin 11 (Syntaxin-11, STX11, FHL4, HLH4, HPLH4) (APC)
134023-APC 100 µL

Syntaxin 11 (Syntaxin-11, STX11, FHL4, HLH4, HPLH4) (APC)

Sign In for Pricing
View Details
Human GRB2 Related Adaptor Protein 2 (GRAP2) Antibody Pair Kit (with Standard)
MBS2090363-01 5x 96 Tests

Human GRB2 Related Adaptor Protein 2 (GRAP2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human GRB2 Related Adaptor Protein 2 (GRAP2) Antibody Pair Kit (with Standard)
MBS2090363-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human GRB2 Related Adaptor Protein 2 (GRAP2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human GRB2 Related Adaptor Protein 2 (GRAP2) Antibody Pair Kit (with Standard)
MBS2090363-03 10x 96 Tests

Human GRB2 Related Adaptor Protein 2 (GRAP2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details