Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp72 Rabbit Polyclonal Antibody (HRP)

Zfp72 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Zfp7, Zfp74

UniProt

Q0VFY0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KECNKTFVRKSLLIQHQRVHTGEKPYKCEQCGKAFSCSSSLTPHQRIHTG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001075149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP14 Rabbit Polyclonal Antibody
ER1803-55 100 µL

USP14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TH1L (NELFCD) (NM_198976) Human Recombinant Protein
TP304842M 100 µg

TH1L (NELFCD) (NM_198976) Human Recombinant Protein

Sign In for Pricing
View Details
Monoclonal Antibody to TLR6 (Clone: ABM1B50)
10-3002-25 25 µg

Monoclonal Antibody to TLR6 (Clone: ABM1B50)

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Human Lambda (Free & Bound),
AA-2108-1 1 mL

Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Human Lambda (Free & Bound),

Sign In for Pricing
View Details
Notch2 Mouse Gene Knockout Kit (CRISPR)
KN311125 1 Kit

Notch2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant CTBP1 Antibody
RC-5671-01 50 μL

Recombinant CTBP1 Antibody

Sign In for Pricing
View Details