Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF321P Rabbit Polyclonal Antibody (FITC)

ZNF321P Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF816-ZNF321

UniProt

Q8N8H1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZN321

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LPELHIFQPEWKIGNQVEKSIINASLILTSQRISCSPKTRISNNYGNNSL

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM138C Protein Vector (Human) (pPB-N-His)
PV076666 500 ng

FAM138C Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
GTF3C2, NT (GTF3C2, KIAA0011, General transcription factor 3C polypeptide 2, TF3C-beta, Transcription factor IIIC 110kD subunit, Transcription factor IIIC subunit beta) (FITC) discontinued
036365-FITC 200 µL

GTF3C2, NT (GTF3C2, KIAA0011, General transcription factor 3C polypeptide 2, TF3C-beta, Transcription factor IIIC 110kD subunit, Transcription factor IIIC subunit beta) (FITC) discontinued

Sign In for Pricing
View Details
Polymyxin B2
T25971 5 mg

Polymyxin B2

Sign In for Pricing
View Details
SMYD2 (N-lysine Methyltransferase SMYD2, HSKM-B, Histone Methyltransferase SMYD2, Lysine N-Methyltransferase 3C, SET and MYND Domain-containing Protein 2, KMT3C)
334925-01 50 µL

SMYD2 (N-lysine Methyltransferase SMYD2, HSKM-B, Histone Methyltransferase SMYD2, Lysine N-Methyltransferase 3C, SET and MYND Domain-containing Protein 2, KMT3C)

Sign In for Pricing
View Details
SMYD2 (N-lysine Methyltransferase SMYD2, HSKM-B, Histone Methyltransferase SMYD2, Lysine N-Methyltransferase 3C, SET and MYND Domain-containing Protein 2, KMT3C)
334925-02 100 µL

SMYD2 (N-lysine Methyltransferase SMYD2, HSKM-B, Histone Methyltransferase SMYD2, Lysine N-Methyltransferase 3C, SET and MYND Domain-containing Protein 2, KMT3C)

Sign In for Pricing
View Details
KIAA1549 Recombinant Protein (Human)
RP066726 100 µg

KIAA1549 Recombinant Protein (Human)

Sign In for Pricing
View Details