Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF320 Rabbit Polyclonal Antibody (HRP)

ZNF320 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZFPL

UniProt

A2RRD8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF320

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NDHEAPMTEIKKLTSSTDRYDQRHAGNKPIKGQLESRFHLHLRRHRRIHT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_997216

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SECTM1A Protein (C-His, Mouse)
P518184 100 µg

SECTM1A Protein (C-His, Mouse)

Sign In for Pricing
View Details
TRIM55 3'UTR GFP Stable Cell Line
TU076566 1.0 mL

TRIM55 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CD11B (Integrin alpha-M, CD11 Antigen-like Family Member B, CR-3 alpha Chain, Cell Surface Glycoprotein MAC-1 Subunit alpha, Leukocyte Adhesion Receptor MO1, Neutrophil Adherence Receptor, ITGAM, CR3A, MGC117044) (MaxLight 750)
MBS6231986-01 0.1 mL

CD11B (Integrin alpha-M, CD11 Antigen-like Family Member B, CR-3 alpha Chain, Cell Surface Glycoprotein MAC-1 Subunit alpha, Leukocyte Adhesion Receptor MO1, Neutrophil Adherence Receptor, ITGAM, CR3A, MGC117044) (MaxLight 750)

Sign In for Pricing
View Details
CD11B (Integrin alpha-M, CD11 Antigen-like Family Member B, CR-3 alpha Chain, Cell Surface Glycoprotein MAC-1 Subunit alpha, Leukocyte Adhesion Receptor MO1, Neutrophil Adherence Receptor, ITGAM, CR3A, MGC117044) (MaxLight 750)
MBS6231986-02 5x 0.1 mL

CD11B (Integrin alpha-M, CD11 Antigen-like Family Member B, CR-3 alpha Chain, Cell Surface Glycoprotein MAC-1 Subunit alpha, Leukocyte Adhesion Receptor MO1, Neutrophil Adherence Receptor, ITGAM, CR3A, MGC117044) (MaxLight 750)

Sign In for Pricing
View Details
Regavirumab
T77146 5 mg

Regavirumab

Sign In for Pricing
View Details
Lentiviral human KRTAP15-1 shRNA (UAS) - Lentiviral human KRTAP15-1 shRNA (UAS) (100)
GTR15320205 1 Vial

Lentiviral human KRTAP15-1 shRNA (UAS) - Lentiviral human KRTAP15-1 shRNA (UAS) (100)

Sign In for Pricing
View Details