Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF883 Rabbit Polyclonal Antibody (FITC)

ZNF883 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P0CG24

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF883

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MESEKIYMTANPYLCTECGKGYTCLASLTQHQKTHIGEKPYECKICGKSF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001094808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL50P1 3'UTR Luciferase Stable Cell Line
TU014590 1.0 mL

MRPL50P1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HMG2 (High-mobility Group Box 2, High Mobility Group Protein B2, High Mobility Group Protein 2, HMG-2, HMGB2) (Biotin)
127943-Biotin 100 µL

HMG2 (High-mobility Group Box 2, High Mobility Group Protein B2, High Mobility Group Protein 2, HMG-2, HMGB2) (Biotin)

Sign In for Pricing
View Details
Tributyl Phosphate 99% For Synthesis
02745 00500 500 mL

Tributyl Phosphate 99% For Synthesis

Sign In for Pricing
View Details
CDC25A 3'UTR Luciferase Stable Cell Line
TU003971 1.0 mL

CDC25A 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Beta-Endorphin Receptor (β-EPR) Mouse ELISA Kit
B7752 96 Tests

Beta-Endorphin Receptor (β-EPR) Mouse ELISA Kit

Sign In for Pricing
View Details
CAD Rabbit pAb
APA2992-01 30 µL

CAD Rabbit pAb

Sign In for Pricing
View Details