Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCG_1646157 Rabbit Polyclonal Antibody (FITC)

HCG_1646157 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LOC440122, hCG_1646157

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human hCG_1646157

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ISPLDQEEIRNMKKRIPQAICPDQKIQPKTKESTVQKILWEEPSNAVKMI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_001129759

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSMNP1 (C-9) : m-IgG Fc BP-HRP Bundle
sc-531199 1 Kit

HSMNP1 (C-9) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Lentiviral mouse Pth2 shRNA (UAS) - Lentiviral mouse Pth2 shRNA (UAS) plasmid
GTR15200587 1 Vial

Lentiviral mouse Pth2 shRNA (UAS) - Lentiviral mouse Pth2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis DNA polymerase IV (dinB)
MBS1349107-01 0.02 mg (E-Coli)

Recombinant Staphylococcus epidermidis DNA polymerase IV (dinB)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis DNA polymerase IV (dinB)
MBS1349107-02 0.02 mg (Yeast)

Recombinant Staphylococcus epidermidis DNA polymerase IV (dinB)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis DNA polymerase IV (dinB)
MBS1349107-03 0.1 mg (E-Coli)

Recombinant Staphylococcus epidermidis DNA polymerase IV (dinB)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis DNA polymerase IV (dinB)
MBS1349107-04 0.1 mg (Yeast)

Recombinant Staphylococcus epidermidis DNA polymerase IV (dinB)

Sign In for Pricing
View Details