Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN5C Rabbit Polyclonal Antibody (HRP)

ZSCAN5C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF495C, ZSCAN5CP

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LOC649137

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKCHKRSHTGEKPFECKDCKKVFTYKANLKEHQRIHSGEKPHKCSKCPRA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001131980

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD1 Polyclonal Antibody, Cy3 Conjugated
bs-16376R-Cy3 100 µL

SMAD1 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
RNF224, ID (RNF224, RING finger protein 224) (AP) discontinued
041139-AP 200 µL

RNF224, ID (RNF224, RING finger protein 224) (AP) discontinued

Sign In for Pricing
View Details
Opelkibart Biosimilar (Monoclonal, IgG1-kappa)
A137018 100 µL

Opelkibart Biosimilar (Monoclonal, IgG1-kappa)

Sign In for Pricing
View Details
Aquaporin 4 (AQP4) Magnetic Fluorescence Assay Kit
MBS2155862-01 96 Tests

Aquaporin 4 (AQP4) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Aquaporin 4 (AQP4) Magnetic Fluorescence Assay Kit
MBS2155862-02 5x 96 Tests

Aquaporin 4 (AQP4) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Aquaporin 4 (AQP4) Magnetic Fluorescence Assay Kit
MBS2155862-03 10x 96 Tests

Aquaporin 4 (AQP4) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details