Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF7 Rabbit Polyclonal Antibody (HRP)

ZNF7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KOX4, zf30, HF.16

UniProt

F5H290

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ZNF7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EDCEKIFRWRSHLIIHQRIHTGEKPYKCNDCGKAFNRSSRLTQHQKIHMG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001269726.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLIP Rabbit Polyclonal Antibody (FITC)
orb2087544 100 µL

MLIP Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Probable intracellular septation protein A (PFLU_4881)
MBS7039374-01 0.02 mg

Recombinant Pseudomonas fluorescens Probable intracellular septation protein A (PFLU_4881)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Probable intracellular septation protein A (PFLU_4881)
MBS7039374-02 0.1 mg

Recombinant Pseudomonas fluorescens Probable intracellular septation protein A (PFLU_4881)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Probable intracellular septation protein A (PFLU_4881)
MBS7039374-03 5x 0.1 mg

Recombinant Pseudomonas fluorescens Probable intracellular septation protein A (PFLU_4881)

Sign In for Pricing
View Details
RBBP5 Rabbit pAb, AP conjugated
orb2869702 100 µL

RBBP5 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
EXD3, ID (EXD3, Probable exonuclease mut-7 homolog, Exonuclease 3'-5' domain-containing protein 3) (MaxLight 550) discontinued
035264-ML550 100 µL

EXD3, ID (EXD3, Probable exonuclease mut-7 homolog, Exonuclease 3'-5' domain-containing protein 3) (MaxLight 550) discontinued

Sign In for Pricing
View Details