Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXI3 Rabbit Polyclonal Antibody (HRP)

FOXI3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOC344167

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QGAQLPSSGVFSPTSISEASADTLQLSNSTSNSTGQRSSYYSPFPASTSG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_001126001

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jph2 Protein Vector (Human) (pPM-C-HA)
25258021 500 ng

Jph2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Apolipoprotein CI (APOC1) Human Over-expression Lysate
orb1364957 20 µg

Apolipoprotein CI (APOC1) Human Over-expression Lysate

Sign In for Pricing
View Details
OR4C16 Rabbit Polyclonal Antibody
orb587593 100 µL

OR4C16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GnRHR (Mouse Monoclonal)
G087 100 µg

Anti-GnRHR (Mouse Monoclonal)

Sign In for Pricing
View Details
Timm17b (NM_011591) Mouse Tagged ORF Clone
MG201452 10 µg

Timm17b (NM_011591) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SOX2 (Embryonic Stem Cell Marker) (rSOX2/1791), CF488A conjugate, 0.1mg/mL
BNC883648-100 1x 100 µL

SOX2 (Embryonic Stem Cell Marker) (rSOX2/1791), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details