Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF12 Rabbit Polyclonal Antibody (Biotin)

ZNF12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KOX3, HZF11, GIOT-3, ZNF325

UniProt

P17014

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EWQQLDPEQKITYRDVMLENYSNLVSVGYHIIKPDVISKLEQGEEPWIVE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig F-box/SPRY domain-containing protein 1 (FBXO45) ELISA Kit
MBS7206619-01 48 Well

Guinea pig F-box/SPRY domain-containing protein 1 (FBXO45) ELISA Kit

Sign In for Pricing
View Details
Guinea pig F-box/SPRY domain-containing protein 1 (FBXO45) ELISA Kit
MBS7206619-02 96 Well

Guinea pig F-box/SPRY domain-containing protein 1 (FBXO45) ELISA Kit

Sign In for Pricing
View Details
Guinea pig F-box/SPRY domain-containing protein 1 (FBXO45) ELISA Kit
MBS7206619-03 5x 96 Well

Guinea pig F-box/SPRY domain-containing protein 1 (FBXO45) ELISA Kit

Sign In for Pricing
View Details
Guinea pig F-box/SPRY domain-containing protein 1 (FBXO45) ELISA Kit
MBS7206619-04 10x 96 Well

Guinea pig F-box/SPRY domain-containing protein 1 (FBXO45) ELISA Kit

Sign In for Pricing
View Details
Pro Ligation-Free Cloning Kit (50 rxns)
TBS6098-50 50 Reactions

Pro Ligation-Free Cloning Kit (50 rxns)

Sign In for Pricing
View Details
Recombinant Human Interleukin-33 His Tag
MBS143786-01 0.002 mg

Recombinant Human Interleukin-33 His Tag

Sign In for Pricing
View Details