Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBTFL1 Rabbit Polyclonal Antibody (Biotin)

UBTFL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HMGPI, C11orf27

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LOC642623

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ELVLEAKKCVKKMNKSQKYRNGPDFPKRPLTAYNRFFKESWPQYSQMYPG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

XP_931187

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(4-Chloro-3-fluorophenyl) acetic acid ethyl ester
FC67877-01 0.25 g

(4-Chloro-3-fluorophenyl) acetic acid ethyl ester

Sign In for Pricing
View Details
(4-Chloro-3-fluorophenyl) acetic acid ethyl ester
FC67877-02 0.5 g

(4-Chloro-3-fluorophenyl) acetic acid ethyl ester

Sign In for Pricing
View Details
(4-Chloro-3-fluorophenyl) acetic acid ethyl ester
FC67877-03 1 g

(4-Chloro-3-fluorophenyl) acetic acid ethyl ester

Sign In for Pricing
View Details
(4-Chloro-3-fluorophenyl) acetic acid ethyl ester
FC67877-04 2 g

(4-Chloro-3-fluorophenyl) acetic acid ethyl ester

Sign In for Pricing
View Details
(4-Chloro-3-fluorophenyl) acetic acid ethyl ester
FC67877-05 5 g

(4-Chloro-3-fluorophenyl) acetic acid ethyl ester

Sign In for Pricing
View Details
Human KCNH8 knockout cell line
ABC-KH7685 1 Vial

Human KCNH8 knockout cell line

Sign In for Pricing
View Details