Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN5C Rabbit Polyclonal Antibody (HRP)

ZSCAN5C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZSCAN5CP

UniProt

A6NGD5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZSCAN5A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GNRGDALNLSSPKRSKPDASSISQEEPQGEATPVGNRESPGQAGMNSIHS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Mannan-binding lectin serine peptidase 1, MASP1 ELISA KIT
E5632Hu-01 48 Well

Human Mannan-binding lectin serine peptidase 1, MASP1 ELISA KIT

Sign In for Pricing
View Details
Human Mannan-binding lectin serine peptidase 1, MASP1 ELISA KIT
E5632Hu-02 96 Well

Human Mannan-binding lectin serine peptidase 1, MASP1 ELISA KIT

Sign In for Pricing
View Details
Human Mannan-binding lectin serine peptidase 1, MASP1 ELISA KIT
E5632Hu-03 5x 96 Tests

Human Mannan-binding lectin serine peptidase 1, MASP1 ELISA KIT

Sign In for Pricing
View Details
Human Mannan-binding lectin serine peptidase 1, MASP1 ELISA KIT
E5632Hu-04 10x 96 Tests

Human Mannan-binding lectin serine peptidase 1, MASP1 ELISA KIT

Sign In for Pricing
View Details
FOXO1A Rabbit Polyclonal Antibody (BF680)
orb1581397 100 µL

FOXO1A Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
5-Fluoroorotic acid monohydrate (5-FOA)
F-230-2.5-5g 5 g

5-Fluoroorotic acid monohydrate (5-FOA)

Sign In for Pricing
View Details