Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbpj Rabbit Polyclonal Antibody (FITC)

Rbpj Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Igk, RBP, CBF1, Igkj, RBP-J, RBPjk, Igkjrb, Rbpsuh, Igkrsbp, AI843960, RBP-Jkappa, RBP-J kappa

UniProt

Q3UM17

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Rbpj

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAET

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001074396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serine/Threonine-Protein Kinase/Endoribonuclease IRE1 (ERN1) Antibody
abx376988-01 50 µg

Serine/Threonine-Protein Kinase/Endoribonuclease IRE1 (ERN1) Antibody

Sign In for Pricing
View Details
Serine/Threonine-Protein Kinase/Endoribonuclease IRE1 (ERN1) Antibody
abx376988-02 100 µg

Serine/Threonine-Protein Kinase/Endoribonuclease IRE1 (ERN1) Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Prostatic Acid Phosphatase (PAP)
TRV-0039384-01 20 µL

Polyclonal Antibody to Prostatic Acid Phosphatase (PAP)

Sign In for Pricing
View Details
Polyclonal Antibody to Prostatic Acid Phosphatase (PAP)
TRV-0039384-02 100 µL

Polyclonal Antibody to Prostatic Acid Phosphatase (PAP)

Sign In for Pricing
View Details
Polyclonal Antibody to Prostatic Acid Phosphatase (PAP)
TRV-0039384-03 200 µL

Polyclonal Antibody to Prostatic Acid Phosphatase (PAP)

Sign In for Pricing
View Details
Polyclonal Antibody to Prostatic Acid Phosphatase (PAP)
TRV-0039384-04 1 mL

Polyclonal Antibody to Prostatic Acid Phosphatase (PAP)

Sign In for Pricing
View Details