Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIL3 Rabbit Polyclonal Antibody (Biotin)

PPIL3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CYPJ

UniProt

Q9H2H8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPIL3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_115861

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kir2.1, CT (Cardiac Inward Rectifier Potassium Channel, HHBIRK1, HHIRK1, Inward Rectifier Potassium Channel 2, Inward Rectifier K(+) Channel Kir2.1, IRK1, IRK-1, hIRK1, LQT7, Potassium Channel Inwardly Rectifying Subfamily J Member 2, KCNJ2, SQT3) (MaxLig
MBS6484412-01 0.1 mL

Kir2.1, CT (Cardiac Inward Rectifier Potassium Channel, HHBIRK1, HHIRK1, Inward Rectifier Potassium Channel 2, Inward Rectifier K(+) Channel Kir2.1, IRK1, IRK-1, hIRK1, LQT7, Potassium Channel Inwardly Rectifying Subfamily J Member 2, KCNJ2, SQT3) (MaxLig

Sign In for Pricing
View Details
Kir2.1, CT (Cardiac Inward Rectifier Potassium Channel, HHBIRK1, HHIRK1, Inward Rectifier Potassium Channel 2, Inward Rectifier K(+) Channel Kir2.1, IRK1, IRK-1, hIRK1, LQT7, Potassium Channel Inwardly Rectifying Subfamily J Member 2, KCNJ2, SQT3) (MaxLig
MBS6484412-02 5x 0.1 mL

Kir2.1, CT (Cardiac Inward Rectifier Potassium Channel, HHBIRK1, HHIRK1, Inward Rectifier Potassium Channel 2, Inward Rectifier K(+) Channel Kir2.1, IRK1, IRK-1, hIRK1, LQT7, Potassium Channel Inwardly Rectifying Subfamily J Member 2, KCNJ2, SQT3) (MaxLig

Sign In for Pricing
View Details
L- (-) -Mannose
GC8426-1g 1 g

L- (-) -Mannose

Sign In for Pricing
View Details
Mucin 2 (MUC2) Antibody (BSA and Azide free)
orb3167510 100 µL

Mucin 2 (MUC2) Antibody (BSA and Azide free)

Sign In for Pricing
View Details
Mouse mmu-miR-7038-5p miRNA Antagomir
abx889381-01 10 nmol

Mouse mmu-miR-7038-5p miRNA Antagomir

Sign In for Pricing
View Details
Mouse mmu-miR-7038-5p miRNA Antagomir
abx889381-02 20 nmol

Mouse mmu-miR-7038-5p miRNA Antagomir

Sign In for Pricing
View Details