Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAS1 Rabbit Polyclonal Antibody (HRP)

MAS1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MAS, MGRA

UniProt

P04201

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAS1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002368

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Receptor III For The Fc Region of Immunoglobulin G (FcGRIII) ELISA Kit
MBS9362685-01 48 Well

Porcine Receptor III For The Fc Region of Immunoglobulin G (FcGRIII) ELISA Kit

Sign In for Pricing
View Details
Porcine Receptor III For The Fc Region of Immunoglobulin G (FcGRIII) ELISA Kit
MBS9362685-02 96 Well

Porcine Receptor III For The Fc Region of Immunoglobulin G (FcGRIII) ELISA Kit

Sign In for Pricing
View Details
Porcine Receptor III For The Fc Region of Immunoglobulin G (FcGRIII) ELISA Kit
MBS9362685-03 5x 96 Well

Porcine Receptor III For The Fc Region of Immunoglobulin G (FcGRIII) ELISA Kit

Sign In for Pricing
View Details
Porcine Receptor III For The Fc Region of Immunoglobulin G (FcGRIII) ELISA Kit
MBS9362685-04 10x 96 Well

Porcine Receptor III For The Fc Region of Immunoglobulin G (FcGRIII) ELISA Kit

Sign In for Pricing
View Details
DDB1 Double Nickase Plasmid (h2)
sc-402067-NIC-2 20 µg

DDB1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
BPNT1 Antibody
R35703-100UG 100 µg

BPNT1 Antibody

Sign In for Pricing
View Details