Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLG4 Rabbit Polyclonal Antibody (Biotin)

DLG4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MRD62, PSD95, SAP90, SAP-90

UniProt

P78352

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DLG4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001356

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR1C3 Human Gene Knockout Kit (CRISPR)
KN200210BN 1 Kit

AKR1C3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cell Meter™ Generic Fluorimetric Caspase Binding Assay Kit *Red Fluorescence Optimized for Flow Cytometry*
22822-AAT 100 Tests

Cell Meter™ Generic Fluorimetric Caspase Binding Assay Kit *Red Fluorescence Optimized for Flow Cytometry*

Sign In for Pricing
View Details
Mouse Bpgm activation kit by CRISPRa
GA200437 1 Kit

Mouse Bpgm activation kit by CRISPRa

Sign In for Pricing
View Details
GBE1 Human Gene Knockout Kit (CRISPR)
KN204152LP 1 Kit

GBE1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant SRC (phospho Y530) Antibody
RC-5595-01 50 μL

Recombinant SRC (phospho Y530) Antibody

Sign In for Pricing
View Details
Recombinant SRC (phospho Y530) Antibody
RC-5595-02 100 µL

Recombinant SRC (phospho Y530) Antibody

Sign In for Pricing
View Details