Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFM4 Rabbit Polyclonal Antibody (FITC)

OLFM4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GC1, OLM4, OlfD, GW112, hGC-1, hOLfD, UNQ362, bA209J19.1

UniProt

Q6UX06

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OLFM4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006409

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR2L2 Knockout A549 cell line
GTR15411486 1 Vial

Human OR2L2 Knockout A549 cell line

Sign In for Pricing
View Details
NPAS2 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-19324R-APC-Cy5.5 100 µL

NPAS2 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Human NADH-Cytochrome B5 Reductase 2 (CYB5R2) Protein
abx073442-01 5 µg

Human NADH-Cytochrome B5 Reductase 2 (CYB5R2) Protein

Sign In for Pricing
View Details
Human NADH-Cytochrome B5 Reductase 2 (CYB5R2) Protein
abx073442-02 20 µg

Human NADH-Cytochrome B5 Reductase 2 (CYB5R2) Protein

Sign In for Pricing
View Details
Human NADH-Cytochrome B5 Reductase 2 (CYB5R2) Protein
abx073442-03 1 mg

Human NADH-Cytochrome B5 Reductase 2 (CYB5R2) Protein

Sign In for Pricing
View Details
Mouse SP-D ELISA Kit
EK5517 96 Tests

Mouse SP-D ELISA Kit

Sign In for Pricing
View Details