Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEC Rabbit Polyclonal Antibody (HRP)

TEC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PSCTK4

UniProt

P42680

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TEC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003206

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine C-type lectin domain family 14 member A (CLEC14A) ELISA Kit
MBS7209260-01 48 Well

Porcine C-type lectin domain family 14 member A (CLEC14A) ELISA Kit

Sign In for Pricing
View Details
Porcine C-type lectin domain family 14 member A (CLEC14A) ELISA Kit
MBS7209260-02 96 Well

Porcine C-type lectin domain family 14 member A (CLEC14A) ELISA Kit

Sign In for Pricing
View Details
Porcine C-type lectin domain family 14 member A (CLEC14A) ELISA Kit
MBS7209260-03 5x 96 Well

Porcine C-type lectin domain family 14 member A (CLEC14A) ELISA Kit

Sign In for Pricing
View Details
Porcine C-type lectin domain family 14 member A (CLEC14A) ELISA Kit
MBS7209260-04 10x 96 Well

Porcine C-type lectin domain family 14 member A (CLEC14A) ELISA Kit

Sign In for Pricing
View Details
TOM70 (F4B1Y) Mouse Monoclonal Antibody
CST 98445T 20 µL

TOM70 (F4B1Y) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Stearoyl coenzyme A lithium salt
sc-215906A 10 mg

Stearoyl coenzyme A lithium salt

Sign In for Pricing
View Details