Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf60 Rabbit Polyclonal Antibody (FITC)

C2orf60 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HTYW5, C2orf60

UniProt

A2RUC4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C2orf60

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001034782

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARFIP2 Rabbit Polyclonal Antibody
TA371082 100 µL

ARFIP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
beta Catenin (CTNNB1) pSer33/37/pThr41 Rabbit Polyclonal Antibody
AP20926PU-N 100 µg

beta Catenin (CTNNB1) pSer33/37/pThr41 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MitoBright Green Probe Assay Kit
E-CK-A401-01 20 Assays

MitoBright Green Probe Assay Kit

Sign In for Pricing
View Details
MitoBright Green Probe Assay Kit
E-CK-A401-02 100 Assays

MitoBright Green Probe Assay Kit

Sign In for Pricing
View Details
Human Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1 (GFRa1) ELISA Kit
RDR-GFRa1-Hu-01 96 Tests

Human Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1 (GFRa1) ELISA Kit

Sign In for Pricing
View Details
Human Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1 (GFRa1) ELISA Kit
RDR-GFRa1-Hu-02 48 Tests

Human Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1 (GFRa1) ELISA Kit

Sign In for Pricing
View Details