Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf60 Rabbit Polyclonal Antibody (HRP)

C2orf60 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HTYW5, C2orf60

UniProt

A2RUC4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C2orf60

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001034782

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM3APAS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1280408 1.0 µg DNA

MCM3APAS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
dl-Menthyl Myristate
TRC-M101430-500MG 500 mg

dl-Menthyl Myristate

Sign In for Pricing
View Details
Human CG beta Mouse mAb, PE conjugated
orb2837760 100 µL

Human CG beta Mouse mAb, PE conjugated

Sign In for Pricing
View Details
RMND5A CytoSection
TS404257P5 25 Slides

RMND5A CytoSection

Sign In for Pricing
View Details
N4-Me-dCTP 100mM Sodium Solution
dNTP022-10 10 mL

N4-Me-dCTP 100mM Sodium Solution

Sign In for Pricing
View Details
AFP/Alpha-fetoprotein Monoclonal Mouse Monoclonal Antibody
orb2956141-01 50 µg

AFP/Alpha-fetoprotein Monoclonal Mouse Monoclonal Antibody

Sign In for Pricing
View Details