Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHF13 Rabbit Polyclonal Antibody (HRP)

PHF13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PHF5, SPOC1

UniProt

Q86YI8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PHF13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSCATVSPDQVKEIKTEGKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDD

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_722519

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Inflammatory Protein 1 alpha (MIP-1-alpha, MIP1A, C-C Motif Chemokine 3, CCL3, Chemokine (C-C Motif) Ligand 3, G0/G1 Switch Regulatory Protein 19-1, G0S19-1, LD78ALPHA, PAT 464.1, SIS-beta, Small-inducible Cytokine A3, SCYA3, Tonsillar Lymphocy
MBS6485828-01 0.1 mL

Macrophage Inflammatory Protein 1 alpha (MIP-1-alpha, MIP1A, C-C Motif Chemokine 3, CCL3, Chemokine (C-C Motif) Ligand 3, G0/G1 Switch Regulatory Protein 19-1, G0S19-1, LD78ALPHA, PAT 464.1, SIS-beta, Small-inducible Cytokine A3, SCYA3, Tonsillar Lymphocy

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 alpha (MIP-1-alpha, MIP1A, C-C Motif Chemokine 3, CCL3, Chemokine (C-C Motif) Ligand 3, G0/G1 Switch Regulatory Protein 19-1, G0S19-1, LD78ALPHA, PAT 464.1, SIS-beta, Small-inducible Cytokine A3, SCYA3, Tonsillar Lymphocy
MBS6485828-02 5x 0.1 mL

Macrophage Inflammatory Protein 1 alpha (MIP-1-alpha, MIP1A, C-C Motif Chemokine 3, CCL3, Chemokine (C-C Motif) Ligand 3, G0/G1 Switch Regulatory Protein 19-1, G0S19-1, LD78ALPHA, PAT 464.1, SIS-beta, Small-inducible Cytokine A3, SCYA3, Tonsillar Lymphocy

Sign In for Pricing
View Details
DPYL5 rabbit pAb Antibody
orb2305495-01 50 µL

DPYL5 rabbit pAb Antibody

Sign In for Pricing
View Details
DPYL5 rabbit pAb Antibody
orb2305495-02 100 µL

DPYL5 rabbit pAb Antibody

Sign In for Pricing
View Details
Nucleic Acid Extraction Kit (column)
HTNP1004 50 Tests

Nucleic Acid Extraction Kit (column)

Sign In for Pricing
View Details
GNE (GLCNE, Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine Kinase, UDP-GlcNAc-2-epimerase/ManAc Kinase, UDP-N-acetylglucosamine 2-epimerase, UDP-GlcNAc-2-epimerase, Uridine Diphosphate-N-acetylglucosamine-2-epimerase, N-acetylmannosa
MBS6380052-01 0.1 mL

GNE (GLCNE, Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine Kinase, UDP-GlcNAc-2-epimerase/ManAc Kinase, UDP-N-acetylglucosamine 2-epimerase, UDP-GlcNAc-2-epimerase, Uridine Diphosphate-N-acetylglucosamine-2-epimerase, N-acetylmannosa

Sign In for Pricing
View Details