Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHF6 Rabbit Polyclonal Antibody (FITC)

PHF6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BFLS, BORJ, CENP-31

UniProt

Q5JRC7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PHF6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LEPSSPKSKKKSRKGRPRKTNFKGLSEDTRSTSSHGTDEMESSSYRDRSP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115711

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroxymetronidazole
orb3027310 5 mg

Hydroxymetronidazole

Sign In for Pricing
View Details
Rabbit Anti Human MAPK3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
MBS8424212-01 0.12 mL

Rabbit Anti Human MAPK3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)

Sign In for Pricing
View Details
Rabbit Anti Human MAPK3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
MBS8424212-02 0.2 mL

Rabbit Anti Human MAPK3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)

Sign In for Pricing
View Details
Rabbit Anti Human MAPK3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
MBS8424212-03 5x 0.2 mL

Rabbit Anti Human MAPK3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)

Sign In for Pricing
View Details
WASH RESERVOIR, Slots for 11 Anti-Splash Baffles, Guide Pins for Blotting Station, 128mm Length, 85mm Wide, 32mm Height, 23mm Chamber Depth, 7.1mm X Wall, 10.3mm Y Wall, Guide Pins Protrude 1.5mm, SLAS Footprint, Polypropylene, Autoclavable
VP 540-1 1 EACH

WASH RESERVOIR, Slots for 11 Anti-Splash Baffles, Guide Pins for Blotting Station, 128mm Length, 85mm Wide, 32mm Height, 23mm Chamber Depth, 7.1mm X Wall, 10.3mm Y Wall, Guide Pins Protrude 1.5mm, SLAS Footprint, Polypropylene, Autoclavable

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Urease accessory protein UreG (ureG)
MBS1146047-01 0.02 mg (E-Coli)

Recombinant Prochlorococcus marinus Urease accessory protein UreG (ureG)

Sign In for Pricing
View Details