Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETD3 Rabbit Polyclonal Antibody (HRP)

SETD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HSETD3, C14orf154

UniProt

A0PJU3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SETD3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLTPEDSFALAVASA

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_954574

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF185 antibody
70R-6666 100 µL

RNF185 antibody

Sign In for Pricing
View Details
Recombinant Lodderomyces elongisporus Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)
MBS1000517-01 0.05 mg (E-Coli)

Recombinant Lodderomyces elongisporus Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)

Sign In for Pricing
View Details
Recombinant Lodderomyces elongisporus Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)
MBS1000517-02 0.05 mg (Yeast)

Recombinant Lodderomyces elongisporus Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)

Sign In for Pricing
View Details
Recombinant Lodderomyces elongisporus Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)
MBS1000517-03 0.2 mg (E-Coli)

Recombinant Lodderomyces elongisporus Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)

Sign In for Pricing
View Details
Recombinant Lodderomyces elongisporus Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)
MBS1000517-04 0.05 mg (Baculovirus)

Recombinant Lodderomyces elongisporus Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)

Sign In for Pricing
View Details
Recombinant Lodderomyces elongisporus Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)
MBS1000517-05 0.5 mg (E-Coli)

Recombinant Lodderomyces elongisporus Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)

Sign In for Pricing
View Details