Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMT5B Rabbit Polyclonal Antibody (FITC)

KMT5B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Suv420, Suv4-20, AA117471, Suv420h1, Suv4-20h1, C630029K18Rik

UniProt

Q3U8K7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

ChIP, WB

NCBI Accession Number

NP_001161356

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCY8, ID (Ca(2+)/Calmodulin-activated Adenylyl Cyclase, Adenylyl Cyclase 8, ATP Pyrophosphate-lyase 8, Adenylate Cyclase Type VIII, Adenylate Cyclase Type 8) (AP)
MBS6461576-01 0.2 mL

ADCY8, ID (Ca(2+)/Calmodulin-activated Adenylyl Cyclase, Adenylyl Cyclase 8, ATP Pyrophosphate-lyase 8, Adenylate Cyclase Type VIII, Adenylate Cyclase Type 8) (AP)

Sign In for Pricing
View Details
ADCY8, ID (Ca(2+)/Calmodulin-activated Adenylyl Cyclase, Adenylyl Cyclase 8, ATP Pyrophosphate-lyase 8, Adenylate Cyclase Type VIII, Adenylate Cyclase Type 8) (AP)
MBS6461576-02 5x 0.2 mL

ADCY8, ID (Ca(2+)/Calmodulin-activated Adenylyl Cyclase, Adenylyl Cyclase 8, ATP Pyrophosphate-lyase 8, Adenylate Cyclase Type VIII, Adenylate Cyclase Type 8) (AP)

Sign In for Pricing
View Details
PLV3-CMV-FBN1-3xHA-CopGFP-Puro Plasmid
PVT65334 2 µg

PLV3-CMV-FBN1-3xHA-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
TSSK3 (Testis-specific Serine/threonine-protein Kinase 3, TSSK-3, Testis-specific Kinase 3, TSK3, TSK-3, Serine/threonine-protein Kinase 22C, STK22C, SPOGA3) (MaxLight 650)
MBS6225250-01 0.1 mL

TSSK3 (Testis-specific Serine/threonine-protein Kinase 3, TSSK-3, Testis-specific Kinase 3, TSK3, TSK-3, Serine/threonine-protein Kinase 22C, STK22C, SPOGA3) (MaxLight 650)

Sign In for Pricing
View Details
TSSK3 (Testis-specific Serine/threonine-protein Kinase 3, TSSK-3, Testis-specific Kinase 3, TSK3, TSK-3, Serine/threonine-protein Kinase 22C, STK22C, SPOGA3) (MaxLight 650)
MBS6225250-02 5x 0.1 mL

TSSK3 (Testis-specific Serine/threonine-protein Kinase 3, TSSK-3, Testis-specific Kinase 3, TSK3, TSK-3, Serine/threonine-protein Kinase 22C, STK22C, SPOGA3) (MaxLight 650)

Sign In for Pricing
View Details
Beclin 1 (BECN1, GT197, Beclin-1, Coiled-coil myosin-like BCL2-interacting protein, Protein GT197) (PE)
MBS6278141-01 0.2 mL

Beclin 1 (BECN1, GT197, Beclin-1, Coiled-coil myosin-like BCL2-interacting protein, Protein GT197) (PE)

Sign In for Pricing
View Details