Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMT5C Rabbit Polyclonal Antibody (HRP)

KMT5C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SUV420H2, Suv4-20h2

UniProt

Q86Y97

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SV422

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TLGGWTARYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMET

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPN6 Rabbit pAb
E2120332 100 µL

CAPN6 Rabbit pAb

Sign In for Pricing
View Details
Rat Catestatin (CST) ELISA Kit
MBS3807871-01 48 Well

Rat Catestatin (CST) ELISA Kit

Sign In for Pricing
View Details
Rat Catestatin (CST) ELISA Kit
MBS3807871-02 96 Well

Rat Catestatin (CST) ELISA Kit

Sign In for Pricing
View Details
Rat Catestatin (CST) ELISA Kit
MBS3807871-03 5x 96 Well

Rat Catestatin (CST) ELISA Kit

Sign In for Pricing
View Details
Rat Catestatin (CST) ELISA Kit
MBS3807871-04 10x 96 Well

Rat Catestatin (CST) ELISA Kit

Sign In for Pricing
View Details
Rabbit Kinesin-like protein KIF2C ELISA Kit
MBS7270254-01 48 Well

Rabbit Kinesin-like protein KIF2C ELISA Kit

Sign In for Pricing
View Details