Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHC2 Rabbit Polyclonal Antibody (FITC)

PHC2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PH2, EDR2, HPH2

UniProt

Q8IXK0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PHC2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GMTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

94kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cysteinyl aspartate specific proteinases 1,CASPASE-1 ELISA KIT
JOT-EK1357Ra-01 48 Well

Rat Cysteinyl aspartate specific proteinases 1,CASPASE-1 ELISA KIT

Sign In for Pricing
View Details
Rat Cysteinyl aspartate specific proteinases 1,CASPASE-1 ELISA KIT
JOT-EK1357Ra-02 96 Well

Rat Cysteinyl aspartate specific proteinases 1,CASPASE-1 ELISA KIT

Sign In for Pricing
View Details
AKAP7 (A-kinase Anchor Protein 7 Isoforms alpha and beta, AKAP-7 Isoforms alpha and beta, Protein Kinase A-anchoring Protein 7 Isoforms alpha/beta, A-kinase Anchor Protein 18kD, AKAP 18, AKAP18) (MaxLight 650)
MBS6220822-01 0.1 mL

AKAP7 (A-kinase Anchor Protein 7 Isoforms alpha and beta, AKAP-7 Isoforms alpha and beta, Protein Kinase A-anchoring Protein 7 Isoforms alpha/beta, A-kinase Anchor Protein 18kD, AKAP 18, AKAP18) (MaxLight 650)

Sign In for Pricing
View Details
AKAP7 (A-kinase Anchor Protein 7 Isoforms alpha and beta, AKAP-7 Isoforms alpha and beta, Protein Kinase A-anchoring Protein 7 Isoforms alpha/beta, A-kinase Anchor Protein 18kD, AKAP 18, AKAP18) (MaxLight 650)
MBS6220822-02 5x 0.1 mL

AKAP7 (A-kinase Anchor Protein 7 Isoforms alpha and beta, AKAP-7 Isoforms alpha and beta, Protein Kinase A-anchoring Protein 7 Isoforms alpha/beta, A-kinase Anchor Protein 18kD, AKAP 18, AKAP18) (MaxLight 650)

Sign In for Pricing
View Details
Human MCEMP1 Pre-designed siRNA Set B
SI009341B 1 Each

Human MCEMP1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SPTLC1 (Serine Palmitoyltransferase 1, HSN1, LBC1, LCB1, SPT1, SPTI, HSAN1) (APC)
MBS6449551-01 0.1 mL

SPTLC1 (Serine Palmitoyltransferase 1, HSN1, LBC1, LCB1, SPT1, SPTI, HSAN1) (APC)

Sign In for Pricing
View Details