Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACYBP Rabbit Polyclonal Antibody (Biotin)

CACYBP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SIP, GIG5, PNAS-107, S100A6BP

UniProt

Q9HB71

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CACYBP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055227

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Osbpl2 AAV siRNA Pooled Vector
35754164 1.0 µg

Osbpl2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
AKT1 (NM_005163) Human Recombinant Protein
TP320257 20 µg

AKT1 (NM_005163) Human Recombinant Protein

Sign In for Pricing
View Details
Glutamate Transporter EAAT2 (Excitatory Amino Acid Transporter 2) discontinued
G4003-91-01 250 µL

Glutamate Transporter EAAT2 (Excitatory Amino Acid Transporter 2) discontinued

Sign In for Pricing
View Details
Glutamate Transporter EAAT2 (Excitatory Amino Acid Transporter 2) discontinued
G4003-91-02 500 µL

Glutamate Transporter EAAT2 (Excitatory Amino Acid Transporter 2) discontinued

Sign In for Pricing
View Details
MMP2 (Matrix Metalloproteinase 2, CLG4, MONA, CLG4A, TBE-1, MMP-II) (MaxLight 490)
MBS6426942-01 0.1 mL

MMP2 (Matrix Metalloproteinase 2, CLG4, MONA, CLG4A, TBE-1, MMP-II) (MaxLight 490)

Sign In for Pricing
View Details
MMP2 (Matrix Metalloproteinase 2, CLG4, MONA, CLG4A, TBE-1, MMP-II) (MaxLight 490)
MBS6426942-02 5x 0.1 mL

MMP2 (Matrix Metalloproteinase 2, CLG4, MONA, CLG4A, TBE-1, MMP-II) (MaxLight 490)

Sign In for Pricing
View Details